PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof003740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 235aa    MW: 25748.8 Da    PI: 4.577
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-24032PU_refplantGDBView CDS
PUT-157a-Saccharum_officinarum-24039PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.35.2e-131669356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k ++++ +q++ L + Fe ++++  e+++  A+  gL+ rq  vWFqNrRa++k
  Sof003740 16 KNRRLSXDQVRPLDRSFELENKLEPERKTGXARDXGLQPRQFAVWFQNRRARWK 69
               455899***********************************************9 PP

2HD-ZIP_I/II115.14.2e-3715107193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k rrls +qv+ L++sFe e+kLeperK+  ar+ glqprq avWFqnrRAR+ktkqlE+dy+aL+++yda ++++++L++++++L +e+ke
    Sof003740  15 RKNRRLSXDQVRPLDRSFELENKLEPERKTGXARDXGLQPRQFAVWFQNRRARWKTKQLERDYAALRHSYDAQRHDHDALRRDKDALLAEIKE 107
                  589*************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.7221171IPR001356Homeobox domain
SMARTSM003891.2E-71475IPR001356Homeobox domain
PfamPF000463.3E-101569IPR001356Homeobox domain
CDDcd000863.27E-101572No hitNo description
SuperFamilySSF466891.84E-131582IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-131678IPR009057Homeodomain-like
PfamPF021832.4E-1571112IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
DEEMMASAAA AAVGRKNRRL SXDQVRPLDR SFELENKLEP ERKTGXARDX GLQPRQFAVW  60
FQNRRARWKT KQLERDYAAL RHSYDAQRHD HDALRRDKDA LLAEIKELKA KLGDEEAAAS  120
FTSVKAEPAA SDGPPPVGVG SSESDSSAVL NDADPPVPEA PVPEVQGGTL LDAPCAVAGP  180
AVAVNHGGVF FHGSFLKVEE DETGLLDDDE PCGGFFAVEQ PPPMAWWTEP TEHWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16371RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140555.11e-136uncharacterized protein LOC100272620
SwissprotQ6K4981e-102HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH371e-102HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLK4JC731e-136K4JC73_MAIZE; HB-type transcription factor (Fragment)
TrEMBLB4FAW91e-136B4FAW9_MAIZE; Uncharacterized protein
STRINGGRMZM2G056600_P011e-135(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-37homeobox protein 16